PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe6G318600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family HD-ZIP
Protein Properties Length: 348aa    MW: 39203.6 Da    PI: 8.3607
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe6G318600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox603.7e-19197251256
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        rk+ ++tkeq   Lee F+++++++ ++++ LA++l+L  rqV vWFqNrRa+ k
  Aqcoe6G318600.1.p 197 RKKLRLTKEQSALLEESFKEHPTLNPKQKQVLANELNLRPRQVEVWFQNRRARTK 251
                        678899***********************************************98 PP

2HD-ZIP_I/II122.32.4e-39197286191
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                        +kk+rl+keq++lLEesF+e+ +L+p++K+ la+eL+l+prqv+vWFqnrRARtk+kq+E+d+e+L++++++l++en+rL+ke +eL+ +l
  Aqcoe6G318600.1.p 197 RKKLRLTKEQSALLEESFKEHPTLNPKQKQVLANELNLRPRQVEVWFQNRRARTKLKQTEVDCEVLRKCCQTLTDENRRLHKELQELK-AL 286
                        69*************************************************************************************9.54 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.394193253IPR001356Homeobox domain
SuperFamilySSF466891.58E-18195262IPR009057Homeodomain-like
SMARTSM003897.2E-17195257IPR001356Homeobox domain
CDDcd000862.20E-16197254No hitNo description
Gene3DG3DSA:1.10.10.606.4E-18197251IPR009057Homeodomain-like
PfamPF000461.4E-16197251IPR001356Homeobox domain
PROSITE patternPS000270228251IPR017970Homeobox, conserved site
PfamPF021836.7E-10253287IPR003106Leucine zipper, homeobox-associated
SMARTSM003408.0E-23253296IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009735Biological Processresponse to cytokinin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MWGLFLHNNL SQQIRFSTHS LFRLLIISSN QPSIPIIPHI FSSFPNQRVS SFFFSTISKE  60
GLSFIFCIQM GVDDVCNIGL DLGLSYQGRL HENLLKSDHQ TTKEKPCFKF DHLLLNSSST  120
CVEPSLTLGL SDARNKNSKG YEEIHSCSDL TQPQTSPHTP LSSFSNASIK RERDEDMEVE  180
RVSPRVISDE DEEGSGRKKL RLTKEQSALL EESFKEHPTL NPKQKQVLAN ELNLRPRQVE  240
VWFQNRRART KLKQTEVDCE VLRKCCQTLT DENRRLHKEL QELKALKLSS PLYMQLPAAT  300
LTMCPSCEKI GGGSGGGGES KNRSKSPFTI ATKPHFYNPF SNPSAAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1245253RRARTKLKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00477DAPTransfer from AT4G37790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010248307.11e-116PREDICTED: homeobox-leucine zipper protein HAT22-like
SwissprotP466042e-84HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLA5B6261e-115A5B626_VITVI; Putative uncharacterized protein
STRINGVIT_00s0732g00010.t011e-115(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.13e-82HD-ZIP family protein